Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fucosyltransferase 8/FUT8 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Fucosyltransferase 8/FUT8 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17986920
|
Novus Biologicals
NBP17986920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179869
|
Novus Biologicals
NBP179869 |
100 μL |
Each for $487.50
|
|
|||||
Description
Fucosyltransferase 8/FUT8 Polyclonal specifically detects Fucosyltransferase 8/FUT8 in Human samples. It is validated for Western Blot.Specifications
| Fucosyltransferase 8/FUT8 | |
| Polyclonal | |
| Rabbit | |
| NP_004471 | |
| 2530 | |
| The immunogen for this antibody is FUT8. Peptide sequence LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| alpha-(1,6)-fucosyltransferase, alpha1-6FucT, EC 2.4.1.68, Fucosyltransferase 8, fucosyltransferase 8 (alpha (1,6) fucosyltransferase), GDP-fucose--glycoprotein fucosyltransferase, GDP-L-Fuc:N-acetyl-beta-D-glucosaminide alpha1,6-fucosyltransferase, Glycoprotein 6-alpha-L-fucosyltransferase, MGC26465 | |
| FUT8 | |
| IgG | |
| 47 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title