Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Fucosyltransferase 3/FUT3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP198488
Description
Fucosyltransferase 3/FUT3 Polyclonal specifically detects Fucosyltransferase 3/FUT3 in Human samples. It is validated for Western Blot.Specifications
Lewis A Blood Group Antigen | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
alpha-(1,3/1,4)-fucosyltransferase, Blood group Lewis alpha-4-fucosyltransferase, CD174, EC 2.4.1, EC 2.4.1.65, FT3B, Fucosyltransferase 3, fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group), Fucosyltransferase III, FucT-III, galactoside 3(4)-L-fucosyltransferase, LEfucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood groupincluded), Les, Lewis FT, MGC131739 | |
Rabbit | |
42 kDa | |
100 μL | |
Primary | |
Pig: 77%. | |
Human, Pig | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_000140 | |
ABO | |
The immunogen for this antibody is FUT3/Blood Group Lewis A - C-terminal region. Peptide sequence: RSNYERFLPPDAFIHVDDFQSPKDLARYLQELDKDHARYLSYFRWRETLR | |
Affinity purified | |
RUO | |
2525 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction