FXYD5/Dysadherin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159138

Catalog No. NBP159138

Description

FXYD5/Dysadherin Polyclonal specifically detects FXYD5/Dysadherin in Human samples. It is validated for Western Blot.

Specifications

• Antigen: FXYD5/Dysadherin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DYSAD, dysadherin, FXYD domain containing ion transport regulator 5, FXYD domain-containing ion transport regulator 5, IWU1, KCT1, keratinocytes associated transmembrane protein 1, OIT2, PRO6241, RIC
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96DB9
• Gene Symbols: FXYD5
• Immunogen: Synthetic peptides corresponding to FXYD5(FXYD domain containing ion transport regulator 5) The peptide sequence was selected from the middle region of FXYD5. Peptide sequence SERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITG.
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 53827
• Target Species: Human
• Isotype: IgG