Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
FXYD5/Dysadherin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | FXYD5/Dysadherin |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
FXYD5/Dysadherin Polyclonal specifically detects FXYD5/Dysadherin in Human samples. It is validated for Western Blot.Specifications
FXYD5/Dysadherin | |
Polyclonal | |
Rabbit | |
Human | |
DYSAD, dysadherin, FXYD domain containing ion transport regulator 5, FXYD domain-containing ion transport regulator 5, IWU1, KCT1, keratinocytes associated transmembrane protein 1, OIT2, PRO6241, RIC | |
FXYD5 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q96DB9 | |
53827 | |
Synthetic peptides corresponding to FXYD5(FXYD domain containing ion transport regulator 5) The peptide sequence was selected from the middle region of FXYD5. Peptide sequence SERPSPSTDVQTDPQTLKPSGFHEDDPFFYDEHTLRKRGLLVAAVLFITG. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title