FYCO1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25824125UL

Catalog No. NB393555

Description

FYCO1 Polyclonal specifically detects FYCO1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: FYCO1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: DKFZp779K1152, FLJ13335, FYVE and coiled-coil domain containing 1, FYVE and coiled-coil domain-containing protein 1, MGC126517, RUFY3, RUN and FYVE domain containing 3, ZFYVE7MGC126519, Zinc finger FYVE domain-containing protein 7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79443
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: FYCO1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SDPKSISFSVVFQEAEDTPLDQCKVLIPTTRCNSHKENIQGQLKVRTPGIYMLIFDNTFSRFVSKKVFYHLTVDRPVIYDGSD
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

For Research Use Only