G gamma14 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP156676	100 μL

Catalog No. NBP156676 Supplier Novus Biologicals Supplier No. NBP156676

Description

Rabbit Polyclonal Antibody

G gamma14 Polyclonal specifically detects G gamma14 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: G gamma14
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: O14610
• Gene Alias: G protein cone gamma 8 subunit, gamma-T2 subunit, G-GAMMA-8, G-gamma-9, G-GAMMA-C, GNG8, GNG9G gamma-C, GNGT8, guanine nucleotide binding protein (G protein), gamma transducing activitypolypeptide 2, guanine nucleotide binding protein gamma 9, Guanine nucleotide binding protein gamma transducing activity polypeptide 2, guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2
• Gene Symbols: GNGT2
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to GNGT2 The peptide sequence was selected from the middle region of GNGT2. Peptide sequence KEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS.
• Molecular Weight of Antigen: 8 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 2793
• Test Specificity: This product is specific to Subunit or Isoform: gamma-T2.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only