Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. G protein alpha Antibody, Novus Biologicals™

G protein alpha Antibody, Novus Biologicals™
SDP

Catalog No. NB405810 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB405810 25 μL
NBP189752 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB405810 Supplier Novus Biologicals Supplier No. NBP18975225UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

G protein alpha Polyclonal specifically detects G protein alpha in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen G protein alpha
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Adenylate cyclase-stimulating G alpha protein, AHO, Alternative gene product encoded by XL-exon, Extra large alphas protein, GNAS complex locus, GNAS1GSA, GNASXL, GPSAC20orf45, GSP, guanine nucleotide binding protein (G protein), alpha stimulating activitypolypeptide 1, guanine nucleotide regulatory protein, guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas, MGC33735, NESP, NESP55, neuroendocrine secretory protein, PHP1A, PHP1B, PHP1C, POH, protein ALEX, SCG6, secretogranin VI, XLalphas
Gene Symbols GNAS
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SGQRDIPPEIGEQPEQPPLEAPGAAAPGAGPSPAEEMETEPPHNEPIPVENDGEACGPPEVSRPNFQVLNPAFREAGAHGSYSPPPE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2778
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.