Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
G protein beta 4 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | G protein beta 4 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179681
|
Novus Biologicals
NBP179681 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
G protein beta 4 Polyclonal specifically detects G protein beta 4 in Human samples. It is validated for Western Blot.Specifications
| G protein beta 4 | |
| Polyclonal | |
| Rabbit | |
| Signal Transduction | |
| NP_067642 | |
| 59345 | |
| Synthetic peptide directed towards the middle region of human GNB4. Peptide sequence DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| G protein beta-4 subunit, guanine nucleotide binding protein (G protein), beta polypeptide 4, guanine nucleotide binding protein beta subunit 4, guanine nucleotide-binding protein subunit beta-4, Transducin beta chain 4 | |
| GNB4 | |
| IgG | |
| Affinity Purified | |
| 37 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title