Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
G2E3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15528120UL
Description
G2E3 Polyclonal specifically detects G2E3 in Human samples. It is validated for Western Blot.Specifications
G2E3 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q7L622 | |
G2E3 | |
Synthetic peptides corresponding to KIAA1333(KIAA1333) The peptide sequence was selected from the N terminal of KIAA1333. Peptide sequence IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR. | |
Affinity Purified | |
RUO | |
55632 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
EC 6.3.2, EC 6.3.2.-, FLJ20333, G2/M phase-specific E3 ubiquitin-protein ligase, G2/M-phase specific E3 ubiquitin ligase, G2/M-phase specific E3 ubiquitin protein ligase, KIAA1333PHD finger protein 7B, PHF7B | |
Rabbit | |
80 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction