Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. G2E3 Antibody, Novus Biologicals™

G2E3 Antibody, Novus Biologicals™
SDP

Catalog No. NB15739520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB15739520 20 μL
NBP155281 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB15739520 Supplier Novus Biologicals Supplier No. NBP15528120UL

Description

Rabbit Polyclonal Antibody

G2E3 Polyclonal specifically detects G2E3 in Human samples. It is validated for Western Blot.

Specifications

Antigen G2E3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q7L622
Gene Alias EC 6.3.2, EC 6.3.2.-, FLJ20333, G2/M phase-specific E3 ubiquitin-protein ligase, G2/M-phase specific E3 ubiquitin ligase, G2/M-phase specific E3 ubiquitin protein ligase, KIAA1333PHD finger protein 7B, PHF7B
Gene Symbols G2E3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to KIAA1333(KIAA1333) The peptide sequence was selected from the N terminal of KIAA1333. Peptide sequence IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR.
Molecular Weight of Antigen 80 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55632
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.