G2E3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155281

Catalog No. NBP155281

Description

G2E3 Polyclonal specifically detects G2E3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: G2E3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 6.3.2, EC 6.3.2.-, FLJ20333, G2/M phase-specific E3 ubiquitin-protein ligase, G2/M-phase specific E3 ubiquitin ligase, G2/M-phase specific E3 ubiquitin protein ligase, KIAA1333PHD finger protein 7B, PHF7B
• Host Species: Rabbit
• Molecular Weight of Antigen: 80 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q7L622
• Gene Symbols: G2E3
• Immunogen: Synthetic peptides corresponding to KIAA1333(KIAA1333) The peptide sequence was selected from the N terminal of KIAA1333. Peptide sequence IWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55632
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG