Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

G3BP1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP183404 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP183404 0.1 mL
NB418968 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP183404 Supplier Novus Biologicals Supplier No. NBP183404
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 1 publication

G3BP1 Polyclonal specifically detects G3BP1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen G3BP1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias ATP-dependent DNA helicase VIII, EC 3.6.1, EC 3.6.4.12, EC 3.6.4.13, G3BP-1, G3BPRas-GTPase-activating protein SH3-domain-binding protein, GAP binding protein, GAP SH3 domain-binding protein 1, GTPase activating protein (SH3 domain) binding protein 1, hDH VIII, HDH-VIII, MGC111040, ras GTPase-activating protein-binding protein 1, RasGAP-associated endoribonuclease G3BP
Gene Symbols G3BP1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FRYQDEVFGGFVTEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQAVVSNDMEEHLEEPVAEPEPDPEPEPEQEPVSEIQEEKPEPVLEETAP
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 10146
Test Specificity Specificity of human G3BP1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.