Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
G3BP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | G3BP2 |
---|---|
Dilution | Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Immunoprecipitation |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
G3BP2 Polyclonal antibody specifically detects G3BP2 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin).Specifications
G3BP2 | |
Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry, Immunoprecipitation | |
Unconjugated | |
RUO | |
Human, Mouse, Rat | |
G3BP-2, GAP SH3 domain-binding protein 2, GTPase activating protein (SH3 domain) binding protein 2, KIAA0660, ras GTPase-activating protein-binding protein 2, Ras-GTPase activating protein SH3 domain-binding protein 2 | |
G3BP2 | |
IgG | |
Affinity Purified | |
Specificity of human sG3BP2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
9908 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:KNLEELEEKSTTPPPAEPVSLPQEPPKPRVEAKPEVQSQPPRVREQRPRERPGFPPRGPRPGRGDMEQNDS | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title