G5pr Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18990725UL

Catalog No. NB405726

Description

G5pr Polyclonal specifically detects G5pr in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: G5pr
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/mL, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50-1:200
• Gene Accession No.: Q969Q6
• Gene Symbols: PPP2R3C
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTVTTILIDLNGFWT
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55012
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C14orf10, chromosome 14 open reading frame 10, FLJ20644, G4-1, G5pr, protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma, protein phosphatase 2, regulatory subunit B'', gamma, Protein phosphatase subunit G5PR, rhabdomyosarcoma antigen MU-RMS-40.6A, Rhabdomyosarcoma antigen MU-RMS-40.6A/6C, rhabdomyosarcoma antigen Mu-RMS-40.6C, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma
• Host Species: Rabbit
• Molecular Weight of Antigen: 53 kDa
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only