Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
G5pr Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | G5pr |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
G5pr Polyclonal specifically detects G5pr in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
G5pr | |
Polyclonal | |
Rabbit | |
Human | |
Q969Q6 | |
55012 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:LLDIENKGYLNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTVTTILIDLNGFWT | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
53 kDa |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
C14orf10, chromosome 14 open reading frame 10, FLJ20644, G4-1, G5pr, protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma, protein phosphatase 2, regulatory subunit B'', gamma, Protein phosphatase subunit G5PR, rhabdomyosarcoma antigen MU-RMS-40.6A, Rhabdomyosarcoma antigen MU-RMS-40.6A/6C, rhabdomyosarcoma antigen Mu-RMS-40.6C, serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma | |
PPP2R3C | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title