Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP213948

G9a/EHMT2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP213948 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP213948 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP213948 Supplier Novus Biologicals Supplier No. NBP213948

Description

Rabbit Polyclonal Antibody has been used in 2 publications

G9a/EHMT2 Polyclonal specifically detects G9a/EHMT2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen G9a/EHMT2
Applications Western Blot, KnockDown, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias ankyrin repeat-containing protein, BAT8, C6orf30, chromosome 6 open reading frame 30, DKFZp686H08213, EC 2.1.1.-, EC 2.1.1.43, euchromatic histone-lysine N-methyltransferase 2HLA-B-associated transcript 8, FLJ35547, G9A histone methyltransferase, G9AEm:AF134726.3, H3-K9-HMTase 3, Histone H3-K9 methyltransferase 3, histone-lysine N-methyltransferase, H3 lysine-9 specific 3, HLA-B associated transcript 8, KMT1CNG36/G9a, Lysine N-methyltransferase 1C, NG36, Protein G9a
Gene Symbols EHMT2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: TAAPAPPPLSQDVPGRADTSQPSARMRGHGEPRRPPCDPLADTIDSSGPSLTLPNGGCLSAVGLPLGPGREALEKALVIQESERRKKLR
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Breast Cancer
Primary or Secondary Primary
Gene ID (Entrez) 10919
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.