Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GAB1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP317716100UL
This item is not returnable.
View return policy
Description
GAB1 Polyclonal antibody specifically detects GAB1 in Human samples. It is validated for Western Blot, ImmunofluorescenceSpecifications
GAB1 | |
Polyclonal | |
Western Blot 0.04-0.4 ug/ml, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
GRB2-associated binder 1, GRB2-associated binding protein 1, GRB2-associated-binding protein 1, Growth factor receptor bound protein 2-associated protein 1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: TSKLDTIPDIPPPRPPKPHPAHDRSPVETCSIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRAFP | |
100 μg | |
Apoptosis, Signal Transduction, Tyrosine Kinases | |
2549 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Western Blot, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction