GABARAPL1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP214032

Catalog No. NBP214032

Description

GABARAPL1 Polyclonal specifically detects GABARAPL1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GABARAPL1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: APG8L, APG8-LIKE, ATG8, ATG8B, ATG8L, Early estrogen-regulated protein, GABA(A) receptor-associated protein like 1, gamma-aminobutyric acid receptor-associated protein-like 1, gec1, GEC-1, GEC1GABA(A) receptor-associated protein-like 1, Glandular epithelial cell protein 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GABARAPL1
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: TMGQLYEVMVLVAQYWMPSSAVWHPLALVLDALITHLRSGAEGVIYPDPLTYGSVRL
• Quantity: 0.1 mL
• Research Discipline: Autophagy
• Gene ID (Entrez): 23710
• Target Species: Human
• Isotype: IgG

For Research Use Only