GADD153/CHOP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25850525UL

Catalog No. NB393420

Description

GADD153/CHOP Polyclonal specifically detects GADD153/CHOP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: GADD153/CHOP
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: C/EBP-homologous protein, C/EBP-homologous protein 10, CCAAT/enhancer-binding protein homologous protein, CHOP-10, CHOP10 CEBPZ, CHOPC/EBP zeta, DDIT-3, DNA damage-inducible transcript 3 protein, DNA-damage-inducible transcript 3, GADD153, Growth arrest and DNA damage-inducible protein GADD153
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DDIT3
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ
• Quantity: 25 μL
• Research Discipline: Apoptosis, Cell Cycle and Replication, DNA Repair, Hypoxia, Lipid and Metabolism, Neuroscience, Unfolded Protein Response
• Gene ID (Entrez): 1649
• Target Species: Human
• Isotype: IgG

For Research Use Only