Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GADD153/CHOP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | GADD153/CHOP |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
GADD153/CHOP Polyclonal specifically detects GADD153/CHOP in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
GADD153/CHOP | |
Polyclonal | |
Rabbit | |
Apoptosis, Cell Cycle and Replication, DNA Repair, Hypoxia, Lipid and Metabolism, Neuroscience, Unfolded Protein Response | |
C/EBP-homologous protein, C/EBP-homologous protein 10, CCAAT/enhancer-binding protein homologous protein, CHOP-10, CHOP10 CEBPZ, CHOPC/EBP zeta, DDIT-3, DNA damage-inducible transcript 3 protein, DNA-damage-inducible transcript 3, GADD153, Growth arrest and DNA damage-inducible protein GADD153 | |
DDIT3 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
1649 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title