Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GADD45 alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP255059
Description
GADD45 alpha Polyclonal specifically detects GADD45 alpha in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
GADD45 alpha | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
DDIT-1, DDIT1growth arrest and DNA damage-inducible protein GADD45 alpha, DNA damage-inducible transcript 1 protein, DNA damage-inducible transcript-1, GADD45DNA-damage-inducible transcript 1, growth arrest and DNA-damage-inducible 45 alpha, growth arrest and DNA-damage-inducible, alpha | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
GADD45A | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MTLEEFSAGEQKTERMDKVGDALEEVLSKALSQ | |
100 μL | |
Apoptosis, Cancer | |
1647 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction