Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GAGE1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25470425UL
Description
GAGE1 Polyclonal specifically detects GAGE1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
GAGE1 | |
Polyclonal | |
Immunohistochemistry-Paraffin 1:2500 - 1:5000 | |
Antigen MZ2-F, Cancer/testis antigen 4.1, G antigen 1, GAGE-1, member 1, MGC33825, MZ2-F antigen | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
IgG |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
GAGE1 | |
This antibody was developed against a Recombinant Protein corresponding to amino acids:PPEMIGPMRPEQFSDEVEPATPEEGEPATQRQDPAAA | |
25 μL | |
Cancer | |
2543 | |
Human |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction