Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Galactosylceramidase/GALC Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NB141948 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB141948 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB141948 Supplier Novus Biologicals Supplier No. NBP162280100UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Galactosylceramidase/GALC Polyclonal specifically detects Galactosylceramidase/GALC in Human samples. It is validated for Western Blot.

Specifications

Antigen Galactosylceramidase/GALC
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose
Gene Accession No. P54803
Gene Alias EC 3.2.1.46, galactocerebrosidase, Galactocerebroside beta-galactosidase, Galactosylceramidase, galactosylceramidase (Krabbe disease), Galactosylceramide beta-galactosidase, galactosylceraminidase, GALCERase
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GALC(galactosylceramidase) The peptide sequence was selected from the middle region of GALC. Peptide sequence LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL. The peptide sequence for this immunogen was taken from within the described region.
Purification Method Immunogen affinity purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2581
Target Species Human
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.