Galectin-14/LGALS14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157683

Catalog No. NBP157683

Description

Galectin-14/LGALS14 Polyclonal specifically detects Galectin-14/LGALS14 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Galectin-14/LGALS14
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Charcot-Leyden crystal protein 2, CLC2, gal-14, galectin-14, lectin, galactoside-binding, soluble, 14, MGC22235, Placental Protein 13-Like Protein, PPL13
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 56891
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8TCE9
• Gene Symbols: LGALS14
• Immunogen: Synthetic peptides corresponding to LGALS14(lectin, galactoside-binding, soluble, 14) The peptide sequence was selected from the N terminal of LGALS14. Peptide sequence MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human
• Isotype: IgG