Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Galectin-14/LGALS14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Galectin-14/LGALS14 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Galectin-14/LGALS14 Polyclonal specifically detects Galectin-14/LGALS14 in Human samples. It is validated for Western Blot.Specifications
Galectin-14/LGALS14 | |
Polyclonal | |
Rabbit | |
Human | |
56891 | |
Synthetic peptides corresponding to LGALS14(lectin, galactoside-binding, soluble, 14) The peptide sequence was selected from the N terminal of LGALS14. Peptide sequence MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDI. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Q8TCE9 | |
LGALS14 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title