GALM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156713

Catalog No. NBP156713

Description

GALM Polyclonal specifically detects GALM in Human samples. It is validated for Western Blot, Immunoprecipitation.

Specifications

• Antigen: GALM
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: aldose 1-epimerase, BLOCK 25, EC 5.1.3.3, galactomutarotase, Galactose mutarotase, galactose mutarotase (aldose 1-epimerase), IBD1
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Pig: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunoprecipitation
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunoprecipitation
• Gene Accession No.: Q96C23
• Gene Symbols: GALM
• Immunogen: Synthetic peptides corresponding to GALM(galactose mutarotase (aldose 1-epimerase)) The peptide sequence was selected from the N terminal of GALM. Peptide sequence WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK.
• Quantity: 100 μL
• Research Discipline: Cell Biology, Lipid and Metabolism
• Gene ID (Entrez): 130589
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only