Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GALM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156713
Description
GALM Polyclonal specifically detects GALM in Human samples. It is validated for Western Blot, Immunoprecipitation.Specifications
GALM | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
aldose 1-epimerase, BLOCK 25, EC 5.1.3.3, galactomutarotase, Galactose mutarotase, galactose mutarotase (aldose 1-epimerase), IBD1 | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Bovine: 92%; Pig: 78%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot, Immunoprecipitation | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml, Immunoprecipitation | |
Q96C23 | |
GALM | |
Synthetic peptides corresponding to GALM(galactose mutarotase (aldose 1-epimerase)) The peptide sequence was selected from the N terminal of GALM. Peptide sequence WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK. | |
100 μL | |
Cell Biology, Lipid and Metabolism | |
130589 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction