Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GALNT13 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16261920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16261920 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16261920 Supplier Novus Biologicals Supplier No. NBP16261920UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

GALNT13 Polyclonal specifically detects GALNT13 in Human samples. It is validated for Western Blot.

Specifications

Antigen GALNT13
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8IUC8
Gene Alias EC 2.4.1.41, FLJ16031, FLJ41157, GalNAc transferase 13, GalNAc-T13MGC119459, KIAA1918H_NH0187G20.1, MGC119461, Polypeptide GalNAc transferase 13, polypeptide N-acetylgalactosaminyltransferase 13, pp-GaNTase 13, Protein-UDP acetylgalactosaminyltransferase 13, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 13 (GalNAc-T13), WUGSC:H_NH0187G20.1
Gene Symbols GALNT13
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GALNT13 The peptide sequence was selected form the N terminal of GALNT13. Peptide sequence CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 114805
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.