GALNT14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256187

Catalog No. NBP256187

Description

GALNT14 Polyclonal specifically detects GALNT14 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: GALNT14
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: EC 2.4.1.41, FLJ12691, FLJ13977, GalNac-T10, GalNac-T14, GALNT15, Polypeptide GalNAc transferase 14, polypeptide N-acetylgalactosaminyltransferase 14, polypeptide N-acetylgalactosaminyltransferase 15, pp-GaNTase 14, Protein-UDP acetylgalactosaminyltransferase 14, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase T10, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase T14, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 14 (GalNAc-T14)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79623
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: GALNT14
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IREIILVDDFSNDPDDCKQLIKLPKVKCLRNNERQGLVRSRIRGADIAQGTTLTFLDSHCEVNRDWLQPLLHRVKEDYTRVVCPVIDIINLDTFTYIESASELRGGFDWSLHFQWEQL
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only