GALNT14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169611

Catalog No. NBP169611

Description

GALNT14 Polyclonal specifically detects GALNT14 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GALNT14
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.4.1.41, FLJ12691, FLJ13977, GalNac-T10, GalNac-T14, GALNT15, Polypeptide GalNAc transferase 14, polypeptide N-acetylgalactosaminyltransferase 14, polypeptide N-acetylgalactosaminyltransferase 15, pp-GaNTase 14, Protein-UDP acetylgalactosaminyltransferase 14, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase T10, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase T14, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 14 (GalNAc-T14)
• Host Species: Rabbit
• Molecular Weight of Antigen: 64 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q96FL9
• Gene Symbols: GALNT14
• Immunogen: Synthetic peptides corresponding to GALNT14(UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 14 (GalNAc-T14)) The peptide sequence was selected from the middle region of GALNT14. Peptide sequence LEIVPCSRVGHVFRKKHPYVFPDGNANTYIKNTKRTAEVWMDEYKQYYYA The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79623
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only