GALNTL4 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP317371100UL

Catalog No. NB169817

Description

GALNTL4 Polyclonal antibody specifically detects GALNTL4 in Human samples. It is validated for Immunofluorescence

Specifications

• Antigen: GALNTL4
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: EC 2.4.1.41, GalNAc-T15, GalNAc-T-like protein 4, GalNAc-transferase 18, GALNT15, GALNT18, MGC71806, Polypeptide GalNAc transferase-like protein 4, pp-GaNTase-like protein 4, Protein-UDP acetylgalactosaminyltransferase-like protein 4, putative polypeptide N-acetylgalactosaminyltransferase-like protein 4, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 4, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 15, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase-like 4
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WVTNYIASVYVRGQEPAPDKKLEEDKGDTLKIIERLDHLENVIKQHIQEAPAKPEEAEAEPFTDSSLFAHW
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 374378
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG