GALNTL6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP181845

Catalog No. NBP181845

Description

GALNTL6 Polyclonal specifically detects GALNTL6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GALNTL6
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: EC 2.4.1.41, GalNAc transferase 17, galNAc-T17, GALNT17Polypeptide GalNAc transferase 17, GaNTase 17, MGC44629, polypeptide N-acetylgalactosaminyltransferase-like 6, pp-GaNTase 17, Protein-UDP acetylgalactosaminyltransferase 17, Putative polypeptide N-acetylgalactosaminyltransferase 17, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 17, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 20, UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase-like 6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 442117
• Target Species: Human
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: GALNTL6
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DKHLVKSAEPGEQQTFPLGLGDGQFYSWTDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSN
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only