Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GAPDH Antibody (CL3265), Novus Biologicals™

Mouse Monoclonal Antibody

$393.50 - $661.00

Specifications

Antigen	GAPDH
Dilution	Western Blot 1:500 - 1:1000, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated
Classification	Monoclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP259025 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP259025	100 μL	Each for $661.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393163 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP25902525UL	25 μL	Each for $393.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

GAPDH Monoclonal specifically detects GAPDH in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen	GAPDH
Classification	Monoclonal
Form	Purified
Regulatory Status	RUO
Target Species	Human, Mouse, Rat
Gene ID (Entrez)	2597
Immunogen	This GAPDH antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVIIS
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Western Blot 1:500 - 1:1000, Immunohistochemistry 1:5000 - 1:10000, Immunohistochemistry-Paraffin 1:5000 - 1:10000, Knockdown Validated
Conjugate	Unconjugated
Host Species	Mouse
Research Discipline	Alzheimers Research, Apoptosis, Autophagy, Cancer, DNA Repair, Lipid and Metabolism, Loading Controls, Neurodegeneration, Neuronal Cell Markers, Neuroscience, Nuclear Receptors Coactivators and Corepressors, Signal Transduction, Translation Control
Gene Alias	aging-associated gene 9 protein, EC 1.2.1, EC 1.2.1.12, EC 2.6.99.-, G3PD, GAPD, glyceraldehyde 3-phosphate dehydrogenase, glyceraldehyde-3-phosphate dehydrogenase, MGC88685, Peptidyl-cysteine S-nitrosylase GAPDH
Gene Symbols	GAPDH
Isotype	IgG1
Purification Method	Protein A purified
Molecular Weight of Antigen	36 kDa

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

GAPDH Antibody (CL3265), Novus Biologicals™

Specifications

Description

Specifications

Documents