GARS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP154602

Catalog No. NBP154602

Description

GARS Polyclonal specifically detects GARS in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GARS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AP-4-A synthetase, Charcot-Marie-Tooth neuropathy 2D, Charcot-Marie-Tooth neuropathy, neuronal type, D, Diadenosine tetraphosphate synthetase, DSMAV, glycine tRNA ligase, Glycine--tRNA ligase, glycyl-tRNA synthetase, GlyRSEC 6.1.1.14, HMN5, SMAD1CMT2D
• Host Species: Rabbit
• Molecular Weight of Antigen: 83 kDa
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 2617
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P41250
• Gene Symbols: GARS
• Immunogen: Synthetic peptides corresponding to GARS(glycyl-tRNA synthetase) The peptide sequence was selected from the middle region of GARS. Peptide sequence IEPSFGLGRIMYTVFEHTFHVREGDEQRTFFSFPAVVAPFKCSVLPLSQN.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.