GAS41 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256393

Catalog No. NBP256393

Description

GAS41 Polyclonal specifically detects GAS41 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: GAS41
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: B230215M10Rik, Gas41,4930573H17Rik, GAS41glioma-amplified sequence-41, Glioma-amplified sequence 41, NuBI1, NuBI-1, NuMA binding protein 1, NuMA-binding protein 1, YAF9, YEATS domain containing 4, YEATS domain-containing protein 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: YEATS4
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKD
• Quantity: 100 μL
• Research Discipline: Transcription Factors and Regulators
• Gene ID (Entrez): 8089
• Target Species: Human
• Isotype: IgG

For Research Use Only