Gastrokine 2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP231688

Catalog No. NBP231688

Description

Gastrokine 2 Polyclonal specifically detects Gastrokine 2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Gastrokine 2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: Q86XP6
• Gene Symbols: GKN2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: PPLNNLQWYIYEKQALDNMFSSKYTWVKYNPLESLIKDVDWFLLGSPIEKLCKHIPLYKGEVVENT
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BlblDown-regulated in gastric cancer, BLOT, down regulated in gastric cancer GDDR, gastrokine 2, GDDRdown-regulated in gastric cancer GDDR, PRO813, TFIZ1gastrokine-2, Trefoil factor interactions(z) 1, VLTI465
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 200504
• Target Species: Human
• Isotype: IgG

For Research Use Only