GAT-1/SLC6A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159878

Catalog No. NBP159878

Description

GAT-1/SLC6A1 Polyclonal specifically detects GAT-1/SLC6A1 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GAT-1/SLC6A1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GABA Transporter 1, GABATHG, GABATRGAT-1, GABT1, GAT1sodium- and chloride-dependent GABA transporter 1, solute carrier family 6 (neurotransmitter transporter, GABA), member 1, Solute carrier family 6 member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 67 kDa
• Quantity: 100 μL
• Research Discipline: Neuroscience
• Gene ID (Entrez): 6529
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Accession No.: P30531
• Gene Symbols: SLC6A1
• Immunogen: Synthetic peptides corresponding to SLC6A1(solute carrier family 6 (neurotransmitter transporter, GABA), member 1) The peptide sequence was selected from the middle region of SLC6A1. Peptide sequence CCINSCTSMFAGFVIFSIVGFMAHVTKRSIADVAASGPGLAFLAYPEAVT The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rabbit: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only