Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GATA-6 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $320.71

Specifications

Antigen GATA-6
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
Applications Western Blot, Immunohistochemistry, Immunofluorescence
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126732
View Documents
Novus Biologicals
NBP31091625UL
25 μg
Each for $106.19
Add to cart
 
NB126731
View Documents
Novus Biologicals
NBP310916100UL
100 μg
Each for $320.71
Add to cart
 
Description

Description

GATA-6 Polyclonal antibody specifically detects GATA-6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence
Specifications

Specifications

GATA-6
Western Blot, Immunohistochemistry, Immunofluorescence
Purified
RUO
Human
GATA binding protein 6, GATA-binding factor 6, GATA-binding protein 6, transcription factor GATA-6
The immunogen is a synthetic peptide directed towards the middle region of human GATA-6 (NP_005248). Peptide sequence SGAGAPVMTGAGESTNPENSELKYSGQDGLYIGVSLASPAEVTSSVRPDS
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence
Unconjugated
Rabbit
Phospho Specific, Stem Cell Markers
PBS buffer, 2% sucrose
2627
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit