Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GATM Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15476420UL
Description
GATM Polyclonal specifically detects GATM in Human samples. It is validated for Western Blot.Specifications
GATM | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
P50440 | |
GATM | |
Synthetic peptides corresponding to GATM(glycine amidinotransferase (L-arginine:glycine amidinotransferase)) The peptide sequence was selected from the middle region of GATM. Peptide sequence PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFK | |
Affinity Purified | |
RUO | |
2628 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
AGATtransamidinase, AT, EC 2.1.4, EC 2.1.4.1, glycine amidinotransferase (L-arginine:glycine amidinotransferase), glycine amidinotransferase, mitochondrial, L-arginine:glycine amidinotransferase, Transamidinase | |
Rabbit | |
44 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction