Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GATM Antibody, Novus Biologicals™

GATM Antibody, Novus Biologicals™
SDP

Catalog No. NBP15476420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15476420 20 μL
NBP154764 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15476420 Supplier Novus Biologicals Supplier No. NBP15476420UL

Description

Rabbit Polyclonal Antibody

GATM Polyclonal specifically detects GATM in Human samples. It is validated for Western Blot.

Specifications

Antigen GATM
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P50440
Gene Alias AGATtransamidinase, AT, EC 2.1.4, EC 2.1.4.1, glycine amidinotransferase (L-arginine:glycine amidinotransferase), glycine amidinotransferase, mitochondrial, L-arginine:glycine amidinotransferase, Transamidinase
Gene Symbols GATM
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GATM(glycine amidinotransferase (L-arginine:glycine amidinotransferase)) The peptide sequence was selected from the middle region of GATM. Peptide sequence PCFDAADFIRAGRDIFAQRSQVTNYLGIEWMRRHLAPDYRVHIISFK
Molecular Weight of Antigen 44 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2628
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.