GBAS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238984

Catalog No. NBP238984

Description

GBAS Polyclonal specifically detects GBAS in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: GBAS
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:2500 - 1:5000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Accession No.: O75323
• Gene Symbols: NIPSNAP2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: CSLLPRLRTWTSSSNRSREDSWLKSLFVRKVD
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: glioblastoma amplified sequence, Glioblastoma-amplified sequence, NIPSNAP2NipSnap2,4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 2, protein NipSnap homolog 2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2631
• Target Species: Human
• Isotype: IgG