Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GCAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15486820UL
Description
GCAP1 Polyclonal specifically detects GCAP1 in Human samples. It is validated for Western Blot.Specifications
GCAP1 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
P43080 | |
GUCA1A | |
Synthetic peptides corresponding to GUCA1A(guanylate cyclase activator 1A (retina)) The peptide sequence was selected from the N terminal of GUCA1A. Peptide sequence LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK. | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C6orf131, chromosome 6 open reading frame 131, CORD14, GCAP 1, GCAP1photoreceptor 1, GCAPGUCA, Guanylate cyclase activator 1A, guanylate cyclase activator 1A (retina), guanylin 1, retina, guanylyl cyclase-activating protein 1, GUCA1 | |
Rabbit | |
23 kDa | |
20 μL | |
Vision | |
2978 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction