Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GCAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen	GCAP1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP15486820 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP15486820UL	20 μL	Each for $206.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP154868 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP154868	100 μL	Each for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

GCAP1 Polyclonal specifically detects GCAP1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	GCAP1
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Vision
Gene Alias	C6orf131, chromosome 6 open reading frame 131, CORD14, GCAP 1, GCAP1photoreceptor 1, GCAPGUCA, Guanylate cyclase activator 1A, guanylate cyclase activator 1A (retina), guanylin 1, retina, guanylyl cyclase-activating protein 1, GUCA1
Gene Symbols	GUCA1A
Isotype	IgG
Molecular Weight of Antigen	23 kDa

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Accession No.	P43080
Gene ID (Entrez)	2978
Immunogen	Synthetic peptides corresponding to GUCA1A(guanylate cyclase activator 1A (retina)) The peptide sequence was selected from the N terminal of GUCA1A. Peptide sequence LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLK.
Primary or Secondary	Primary

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

GCAP1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents