Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GCDH Antibody, Novus Biologicals™

GCDH Antibody, Novus Biologicals™
SDP

Catalog No. NBP1546420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1546420 20 μL
NBP154641 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1546420 Supplier Novus Biologicals Supplier No. NBP15464120UL

Description

Rabbit Polyclonal Antibody

GCDH Polyclonal specifically detects GCDH in Human samples. It is validated for Western Blot.

Specifications

Antigen GCDH
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q92947
Gene Alias ACAD5, EC 1.3.99, EC 1.3.99.7, GCD, glutaryl-CoA dehydrogenase, glutaryl-CoA dehydrogenase, mitochondrial, glutaryl-Coenzyme A dehydrogenase
Gene Symbols GCDH
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GCDH(glutaryl-Coenzyme A dehydrogenase) The peptide sequence was selected from the N terminal of GCDH. Peptide sequence SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA.
Molecular Weight of Antigen 43 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 2639
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.