GCH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179771

Catalog No. NBP179771

Description

GCH1 Polyclonal specifically detects GCH1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: GCH1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dystonia 14, DYT14, DYT5a, DYT5EC 3.5.4.16, GCH, GTP cyclohydrolase 1, GTP cyclohydrolase I, GTPCH1, GTP-CH-1, GTP-CH-I, guanosine 5'-triphosphate cyclohydrolase I, HPABH4B
• Host Species: Rabbit
• Molecular Weight of Antigen: 28 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Predicted Homology Based On Immunogen Sequence: Yeast: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_000152
• Gene Symbols: GCH1
• Immunogen: Synthetic peptide directed towards the C terminal of human GCH1The immunogen for this antibody is GCH1. Peptide sequence LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLT.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 2643
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.