Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GCH1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
| Antigen | GCH1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP1797720
|
Novus Biologicals
NBP17977120UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179771
|
Novus Biologicals
NBP179771 |
100 μL |
Each for $499.50
|
|
|||||
Description
GCH1 Polyclonal specifically detects GCH1 in Human samples. It is validated for Western Blot.Specifications
| GCH1 | |
| Polyclonal | |
| Rabbit | |
| NP_000152 | |
| 2643 | |
| Synthetic peptide directed towards the C terminal of human GCH1The immunogen for this antibody is GCH1. Peptide sequence LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLT. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| dystonia 14, DYT14, DYT5a, DYT5EC 3.5.4.16, GCH, GTP cyclohydrolase 1, GTP cyclohydrolase I, GTPCH1, GTP-CH-1, GTP-CH-I, guanosine 5'-triphosphate cyclohydrolase I, HPABH4B | |
| GCH1 | |
| IgG | |
| 28 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title