Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GCH1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17977120UL
Description
GCH1 Polyclonal specifically detects GCH1 in Human samples. It is validated for Western Blot.Specifications
GCH1 | |
Polyclonal | |
Western Blot 1:10000.2-1 ug/ml | |
NP_000152 | |
GCH1 | |
Synthetic peptide directed towards the C terminal of human GCH1The immunogen for this antibody is GCH1. Peptide sequence LRPAGVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLT. | |
Affinity Purified | |
RUO | |
2643 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
dystonia 14, DYT14, DYT5a, DYT5EC 3.5.4.16, GCH, GTP cyclohydrolase 1, GTP cyclohydrolase I, GTPCH1, GTP-CH-1, GTP-CH-I, guanosine 5'-triphosphate cyclohydrolase I, HPABH4B | |
Rabbit | |
28 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction