Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. GCHFR Antibody, Novus Biologicals™

GCHFR Antibody, Novus Biologicals™
SDP

Catalog No. NBP15496020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15496020 20 μL
NBP154960 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15496020 Supplier Novus Biologicals Supplier No. NBP15496020UL

Description

Rabbit Polyclonal Antibody

GCHFR Polyclonal specifically detects GCHFR in Human samples. It is validated for Western Blot.

Specifications

Antigen GCHFR
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. P30047
Gene Alias GFRPP35, GTP cyclohydrolase I feedback regulator, GTP cyclohydrolase I feedback regulatory proteinGTP cyclohydrolase 1 feedback regulatory protein, HsT16933, MGC138467, MGC138469, p35
Gene Symbols GCHFR
Host Species Rabbit
Immunogen Synthetic peptides corresponding to GCHFR(GTP cyclohydrolase I feedback regulator) The peptide sequence was selected from the N terminal of GCHFR. Peptide sequence MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVD.
Molecular Weight of Antigen 10 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2644
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.