Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GCSH Antibody, Novus Biologicals™
SDP

Catalog No. NB035115 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB035115 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB035115 Supplier Novus Biologicals Supplier No. NBP287493
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

GCSH Polyclonal specifically detects GCSH in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen GCSH
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Formulation PBS, 2% Sucrose
Gene Alias GCE, glycine cleavage system H protein, mitochondrial, glycine cleavage system protein H (aminomethyl carrier), lipoic acid-containing protein, mitochondrial glycine cleavage system H-protein, NKH
Host Species Rabbit
Immunogen The immunogen is a synthetic peptide directed towards the following sequence IGTVGISNFAQEALGDVVYCSLPEVGTKLNKQDEFGALESVKAASELYSP
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 2653
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.