Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

GDF-9 Antibody (53/1), Alexa Fluor™ 532, Novus Biologicals™
SDP

Catalog No. NP261934A32 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NP261934A32 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NP261934A32 Supplier Novus Biologicals Supplier No. NBP261934AF532
Add to Cart
Add to Cart

Mouse Monoclonal Antibody

GDF-9 Monoclonal specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry.

Specifications

Antigen GDF-9
Applications Western Blot, ELISA, Immunohistochemistry
Classification Monoclonal
Clone 53/1
Conjugate Alexa Fluor 532
Dilution Western Blot, ELISA, Immunohistochemistry
Formulation 50 mM sodium borate with 0.05% sodium azide
Gene Alias GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9
Gene Symbols GDF9
Host Species Mouse
Immunogen Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9
Purification Method Protein A purified
Quantity 0.1 mL
Research Discipline Cytokine Research
Primary or Secondary Primary
Gene ID (Entrez) 2661
Target Species Human
Content And Storage Store at 4°C in the dark.
Isotype IgG1
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.