Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GDF-9 Antibody (53/1) - Azide and BSA Free, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP2619340.025MG
Description
GDF-9 Monoclonal specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry.Specifications
GDF-9 | |
Monoclonal | |
1 mg/mL | |
PBS with 0.02% Sodium Azide | |
GDF9 | |
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9 | |
0.025 mg | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG1 |
ELISA, Immunohistochemistry, Western Blot | |
53/1 | |
Unconjugated | |
GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9 | |
Mouse | |
Protein A purified | |
Cytokine Research | |
2661 | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction