Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
---Azide-and-BSA-Free-ELISA-NBP2-61934-img0003.jpg-650.jpg)
---Azide-and-BSA-Free-ELISA-NBP2-61934-img0002.jpg-650.jpg)
---Azide-and-BSA-Free-ELISA-NBP2-61934-img0004.jpg-650.jpg)
---Azide-and-BSA-Free-ELISA-NBP2-61934-img0001.jpg-650.jpg)
GDF-9 Antibody (53/1) - Azide and BSA Free, Novus Biologicals™
Mouse Monoclonal Antibody
$196.10 - $499.50
Specifications
| Antigen | GDF-9 |
|---|---|
| Clone | 53/1 |
| Applications | ELISA, Immunohistochemistry, Western Blot |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
Description
GDF-9 Monoclonal specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry.Specifications
| GDF-9 | |
| ELISA, Immunohistochemistry, Western Blot | |
| Unconjugated | |
| Mouse | |
| PBS with 0.02% Sodium Azide | |
| 2661 | |
| Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9 | |
| Primary |
| 53/1 | |
| Monoclonal | |
| Purified | |
| Cytokine Research | |
| GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9 | |
| GDF9 | |
| IgG1 | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title