Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
GDF-9 Antibody (GDF9/4261), DyLight 350, Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP308362UV
Description
GDF-9 Monoclonal antibody specifically detects GDF-9 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry (Paraffin)Specifications
GDF-9 | |
Monoclonal | |
DyLight 350 | |
GDF9, GDF-9, growth differentiation factor 9, growth/differentiation factor 9 | |
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF-9. (Uniprot: O60383) | |
100 μg | |
Cytokine Research | |
2661 | |
Store at 4°C in the dark. | |
IgG1 |
Western Blot, ELISA, Immunohistochemistry (Paraffin) | |
GDF9/4261 | |
50mM Sodium Borate | |
Mouse | |
Protein A or G purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction